PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000168728
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 221aa    MW: 24839.2 Da    PI: 4.3897
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000168728genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l   ++++G g+W++ ++  g+ R++k+c++rw +yl
    MDP0000168728 14 KGPWTSEEDQILTSFIQKYGHGNWRALPKQAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding461.3e-1467106142
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42 
                      rg++T eE+e +++++ +lG++ W++Ia++++ gRt++++k+
    MDP0000168728  67 RGNFTREEEEAIIKLHDMLGNR-WSAIAARLP-GRTDNEIKN 106
                      89********************.*********.*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129421.738965IPR017930Myb domain
SuperFamilySSF466892.55E-3010106IPR009057Homeodomain-like
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002493.7E-151461IPR001005SANT/Myb domain
CDDcd001676.90E-111661No hitNo description
Gene3DG3DSA:1.10.10.606.2E-2165106IPR009057Homeodomain-like
PROSITE profilePS5129413.82466116IPR017930Myb domain
SMARTSM007171.9E-766109IPR001005SANT/Myb domain
PfamPF002495.4E-1367106IPR001005SANT/Myb domain
CDDcd001672.06E-969106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTSE EDQILTSFIQ KYGHGNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDTKRGNF TREEEEAIIK LHDMLGNRWS AIAARLPGRT DNEIKNPSSS DVSSSVTEVS  120
GALSSDQDTI IVKGENMEPW ETFPEIDDSF WSEALSANNS STPLLFPXAE NDETISEFPI  180
TANDSEELGF XFGLNLDDGM EFWYDLFVRT GHGGTPELPE F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744711e-149DQ074471.1 Malus x domestica MYB23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008351312.11e-146PREDICTED: myb-related protein Myb4-like
TrEMBLQ2LME11e-128Q2LME1_MALDO; MYB23
STRINGGLYMA20G35180.12e-82(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.16e-69myb domain protein 14